DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA1d

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_193615.1 Gene:RABA1d / 827614 AraportID:AT4G18800 Length:214 Species:Arabidopsis thaliana


Alignment Length:184 Identity:88/184 - (47%)
Similarity:113/184 - (61%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQ 67
            :.||||||.::||.:|.|||.||..|..::|..:|..||||||.:|.:||..|.:|.||||||||
plant     8 DDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVNEKVIKAQIWDTAGQ 72

  Fly    68 ERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVT 132
            ||:|::|.:|||||.|||||||.|...:|..:..||.:.|....||||::|||||.||.....|.
plant    73 ERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLVGNKSDLRHLVAVQ 137

  Fly   133 FLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI---------ETGE 177
            ..:|.:||:...|.|:||||....|||.||    ..:|.:|         |.||
plant   138 TEDAKSFAENESLYFMETSALESTNVENAF----SEVLTQIYHVVSKKAMEAGE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 79/159 (50%)
RABA1dNP_193615.1 Rab11_like 11..175 CDD:206660 83/167 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.