DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA2c

DIOPT Version :10

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_190267.1 Gene:RABA2c / 823836 AraportID:AT3G46830 Length:217 Species:Arabidopsis thaliana


Alignment Length:173 Identity:86/173 - (49%)
Similarity:115/173 - (66%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            :.:.||||||.::||.:|.|||.:|..|..::|..:|..||||||.:|...|.||::|.||||||
plant     5 VDQEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTA 69

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130
            ||||:|::|.:|||||.|||||||.|.|.:|:.:..||.:.|..|..||||::.|||.||...|.
plant    70 GQERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDLNHLRS 134

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI 173
            |...:..:.|::..|.||||||....|||:||    :|||.:|
plant   135 VAEEDGQSLAEKEGLSFLETSALEATNVEKAF----QTILGEI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 78/159 (49%)
RABA2cNP_190267.1 PLN03110 1..217 CDD:178657 86/173 (50%)

Return to query results.
Submit another query.