DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab14

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_080973.1 Gene:Rab14 / 68365 MGIID:1915615 Length:215 Species:Mus musculus


Alignment Length:208 Identity:122/208 - (58%)
Similarity:152/208 - (73%) Gaps:1/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQER 69
            |.|:||::|||..|.|||||||.|.|.||..|..||||||||:||:.|.|:.:||||||||||||
Mouse     8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQER 72

  Fly    70 FRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFL 134
            ||:|||||||||||||:|||.|.|.::|.|::||.|||.|.:||.||:|:|||.|||..||||:.
Mouse    73 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYE 137

  Fly   135 EASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALRNLQ- 198
            ||..||:||.|:|||.|||||||||:|||:.:|.|...|:.|.||.....||:|:..:|.:..: 
Mouse   138 EAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRL 202

  Fly   199 TRQRSINKPDCTC 211
            |.:....:..|.|
Mouse   203 TSEPQPQREGCGC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 108/159 (68%)
Rab14NP_080973.1 Rab14 10..175 CDD:133322 110/164 (67%)
Effector region. /evidence=ECO:0000250 40..48 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..215 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.