DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and rab4b

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_031746337.1 Gene:rab4b / 549741 XenbaseID:XB-GENE-946075 Length:234 Species:Xenopus tropicalis


Alignment Length:210 Identity:163/210 - (77%)
Similarity:187/210 - (89%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERF 70
            |:|||||:|||||:|||||||.|||:|||.||:||||||||||||||||||||||||||||||||
 Frog    27 DFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERF 91

  Fly    71 RSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLE 135
            |||||||||||||||||||..||:::|||||||.||||||||||:|:|.||||||:..|:|||||
 Frog    92 RSVTRSYYRGAAGALLVYDIASRETYNALTNWLTDARTLASPNIIIILCGNKKDLDADREVTFLE 156

  Fly   136 ASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALRNLQ-- 198
            ||.|||||||:||||||.||||||||||||::|||:|||:|||||||:.||||||.|:.|:.:  
 Frog   157 ASRFAQENELMFLETSALTGENVEEAFLKCARTILSKIESGELDPERMWSGIQYGDASPRHAKHS 221

  Fly   199 --TRQRSINKPDCTC 211
              |:|:  |:..|.|
 Frog   222 HGTQQQ--NRQQCNC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 135/159 (85%)
rab4bXP_031746337.1 Rab4 30..190 CDD:206696 135/159 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 280 1.000 Domainoid score I1660
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100632
Inparanoid 1 1.050 326 1.000 Inparanoid score I2439
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - oto105321
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.