DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab4b

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_059051.1 Gene:Rab4b / 50866 RGDID:620931 Length:213 Species:Rattus norvegicus


Alignment Length:213 Identity:164/213 - (76%)
Similarity:187/213 - (87%) Gaps:2/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            |:||||:|||||:|||||:|||||||.|||:|||.||:||||||||||:||||||:|||||||||
  Rat     1 MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTA 65

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130
            ||||||||||||||||||||||||.|||:::|:|..||.|||||||||||::|.||||||:..|:
  Rat    66 GQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPERE 130

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALR 195
            |||||||.|||||||:||||||.||||||||||||::|||.||::|||||||:|||||||..:||
  Rat   131 VTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDISLR 195

  Fly   196 NL-QTRQRSINKPD-CTC 211
            .| |.|......|. |.|
  Rat   196 QLRQPRSAQAVAPQPCGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 131/159 (82%)
Rab4bNP_059051.1 Rab4 9..169 CDD:206696 131/159 (82%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351391
Domainoid 1 1.000 274 1.000 Domainoid score I1705
eggNOG 1 0.900 - - E2759_KOG0086
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100632
Inparanoid 1 1.050 332 1.000 Inparanoid score I2343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - otm46320
orthoMCL 1 0.900 - - OOG6_102241
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X808
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.