DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and rab4b

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001004002.1 Gene:rab4b / 445498 ZFINID:ZDB-GENE-040822-15 Length:213 Species:Danio rerio


Alignment Length:213 Identity:167/213 - (78%)
Similarity:190/213 - (89%) Gaps:2/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            ||||||:|||||:|||||:|||||||.|||:|||.||:||||||||||:||||||:|||||||||
Zfish     1 MSETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTA 65

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130
            ||||||||||||||||||||||||.|||:::|||||||.||||||||||||:|.||||||:..|:
Zfish    66 GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARTLASPNIVIILCGNKKDLDADRE 130

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALR 195
            |||||||.|||||||:||||||.||||||||||||:::|..|||:|||||||:|||||||.|:||
Zfish   131 VTFLEASRFAQENELMFLETSALTGENVEEAFLKCARSIPNKIESGELDPERMGSGIQYGDASLR 195

  Fly   196 NLQTRQRSI--NKPDCTC 211
            .::..:.|.  .|..|.|
Zfish   196 QIRQPRGSAAQTKQQCNC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 135/159 (85%)
rab4bNP_001004002.1 RAB 9..172 CDD:197555 136/162 (84%)
Rab4 9..169 CDD:206696 135/159 (85%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593196
Domainoid 1 1.000 277 1.000 Domainoid score I1696
eggNOG 1 0.900 - - E2759_KOG0086
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100632
Inparanoid 1 1.050 337 1.000 Inparanoid score I2359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - otm26014
orthoMCL 1 0.900 - - OOG6_102241
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.