DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and rab11bb

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001002555.1 Gene:rab11bb / 436828 ZFINID:ZDB-GENE-040718-293 Length:218 Species:Danio rerio


Alignment Length:171 Identity:89/171 - (52%)
Similarity:114/171 - (66%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQ 67
            :.||:|||.::||.:|.|||.||..|..::|..:|..||||||.:|.:.|.||::|.||||||||
Zfish     6 DEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ 70

  Fly    68 ERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVT 132
            ||:|::|.:|||||.|||||||.....::..:..||.:.|..|..||||:|||||.||...|.|.
Zfish    71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVP 135

  Fly   133 FLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI 173
            ..||..||::|.|.|:||||....||||||    |.||.:|
Zfish   136 TDEARAFAEKNNLSFIETSALDSTNVEEAF----KNILTEI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 83/159 (52%)
rab11bbNP_001002555.1 PLN03110 1..217 CDD:178657 89/171 (52%)
Rab11_like 9..173 CDD:206660 88/168 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.