DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab7

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:219 Identity:78/219 - (35%)
Similarity:119/219 - (54%) Gaps:20/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            ||.....|.|.:|:|.:..||:.|::.::..:|.:....|||.:|.::.|.|..:.|.:||||||
  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASP----NIVILLVGNKKDLE 126
            |||||:|:..::||||...:||||.|:.:||..|.:|.::....|||    :...:::|||.||:
  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130

  Fly   127 EARDVTFLEASTFAQ-ENELIFLETSAKTGENVEEAFLKCSKTIL---AKIETGELDPERIGSGI 187
            . |.|:...|..:.| :|::.:.|||||.|.|||.||...:|..|   |:.|.....|::|..|.
  Fly   131 N-RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGS 194

  Fly   188 QYGGAALRNLQTRQRSINKPDCTC 211
            |           ..|..|..:|.|
  Fly   195 Q-----------NNRPGNPDNCQC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 64/164 (39%)
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 65/170 (38%)
RAB 9..174 CDD:197555 64/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.