DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab1

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster


Alignment Length:180 Identity:86/180 - (47%)
Similarity:117/180 - (65%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQER 69
            ||||||.|:||.:|.||||||..|.:..:.:....||||:|..|.:.:.||::||||||||||||
  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72

  Fly    70 FRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFL 134
            ||::|.||||||.|.::|||.|.::|||.:..||.:....|..|:..||||||.||...:.|...
  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137

  Fly   135 EASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIG 184
            .|:.:|.:..:.|||||||:..|||:||:    |:.|:|:      .|:|
  Fly   138 TAAEYAAQLGIPFLETSAKSATNVEQAFM----TMAAEIK------NRVG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 77/159 (48%)
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 82/174 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.