DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab26

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:219 Identity:77/219 - (35%)
Similarity:123/219 - (56%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDD-SSHTIGVEFGSRIVNVGGKSVKLQIWDTAG 66
            :.:|.:.|.:::|.:|.||:.||..|.:.::... ...|:|::|.:::|.|.|..||||||||||
  Fly   207 DEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAG 271

  Fly    67 QERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLE-EARD 130
            ||||||||.:|||.|...||:||.|::.:::.:..||.:.|..|..::||:|:|||.|.. ..|.
  Fly   272 QERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQ 336

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALR 195
            |...:.....:|:.:.|:|||||||.|||.:|...::.:.::             |.::|.....
  Fly   337 VKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR-------------GYEHGDDGKF 388

  Fly   196 NL------QTRQRSINKPDCT-CR 212
            |:      .|:.||:    |. ||
  Fly   389 NVHDFVRDNTKARSV----CAQCR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 67/161 (42%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 74/209 (35%)
RAB 214..378 CDD:197555 67/163 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.