DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and rab4a

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001119853.1 Gene:rab4a / 403031 ZFINID:ZDB-GENE-040525-1 Length:213 Species:Danio rerio


Alignment Length:215 Identity:162/215 - (75%)
Similarity:188/215 - (87%) Gaps:6/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            ||||||:|||||:||:||:|||||||.|||.:|||||:|||||||||:|::|..|.|||||||||
Zfish     1 MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKRFKDDSNHTIGVEFGSKIISVVNKFVKLQIWDTA 65

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130
            ||||||||||||||||||||||||.|||:::|||||||.|||.|||.||||:|.||||||:..|:
Zfish    66 GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADRE 130

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALR 195
            |||||||.|||||||:||||||.|||||||||::|::.||.|||:|||||||:|||||||.||||
Zfish   131 VTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALR 195

  Fly   196 NLQTRQR----SINKPDCTC 211
            .|::.:|    ||.  :|.|
Zfish   196 QLRSPRRAQAESIQ--ECGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 126/159 (79%)
rab4aNP_001119853.1 RAB 9..172 CDD:197555 128/162 (79%)
Rab4 9..169 CDD:206696 126/159 (79%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1696
eggNOG 1 0.900 - - E2759_KOG0086
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - otm26014
orthoMCL 1 0.900 - - OOG6_102241
Panther 1 1.100 - - O PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1999
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.