DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab8

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster


Alignment Length:203 Identity:88/203 - (43%)
Similarity:123/203 - (60%) Gaps:7/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            |::|||||||.|:||.:|.||:|:|..|.|..|......|||::|..|.:.:..|.:||||||||
  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130
            ||||||::|.:|||||.|.:||||.|...||..:.||:.:....||.::..:|:|||.:|.:.|.
  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERI-GSGIQYGGAAL 194
            |:.......|.|..:.|:|||||...|||||||..:..|.||.|      :|: .:....||..|
  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTE------KRMEANNPPKGGHQL 189

  Fly   195 RNLQTRQR 202
            :.:.:|.:
  Fly   190 KPMDSRTK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 73/159 (46%)
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 77/165 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.