DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RabX6

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:215 Identity:72/215 - (33%)
Similarity:107/215 - (49%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KFLIIGSAGSGKSCLLHHFIESKFKDDSSH--TIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRS 72
            |.::.|..|.|||.|...|..:.|..|:..  |:|::...|..:|..|.:|||:|||.|.||..|
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly    73 VTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLE-EARDVTFLEA 136
            ||.|||:.|.||:||:...:..||::|:..|.|..|.|. |..|.:.|||.||: ...:|:..|.
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   137 STFAQE-NELI--FLETSAKTGENVEEAFLKCSKTIL----AKIETGELDPERIGSGIQYGGAAL 194
            ..|.:: :.||  ..:||.::|..|||.|...|:.::    :|:|...|:.:.........||| 
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAA- 202

  Fly   195 RNLQTRQRSINKPD---CTC 211
                     .|:.|   |.|
  Fly   203 ---------TNEEDASSCGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 62/164 (38%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 62/166 (37%)
Rab 10..172 CDD:206640 61/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.