DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab32

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:191 Identity:64/191 - (33%)
Similarity:103/191 - (53%) Gaps:16/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKS-VKLQIWDTA 65
            |:..::|:|.|:||..|:||:..:..::...|..:...||||:|..:::.....: |:||:||.|
  Fly   477 SDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIA 541

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTL-----ASPNIVILLVGNKKDL 125
            |||||.::||.||:.|.||.:|:|.|...:|:.::.|..|..:.     .|| |..:|:.||.|.
  Fly   542 GQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSP-IPCILLANKCDQ 605

  Fly   126 EEARDVTFLE-ASTFAQENELI-FLETSAKTGENVEEA-------FLKCSKTILAKIETGE 177
            |:...:|..| ...:.:||... :.|||||...|::||       .|...|.|.|.:..|:
  Fly   606 EKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGD 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 59/174 (34%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 62/184 (34%)
RAB 484..652 CDD:197555 57/168 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.