DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab9E

DIOPT Version :10

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster


Alignment Length:129 Identity:26/129 - (20%)
Similarity:37/129 - (28%) Gaps:48/129 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1312 LGLEATKEDNLPDWYSQVITKGEMIEYY--DVSGC---YILR--HWSFAIWKAIRNWFDAEITKL 1369
            :|.:...|:|..||      |.|..|.|  :...|   |.|:  .|.|.:...      |.:|..
  Fly   165 IGFKLDTEENQKDW------KREYYEEYKAEFVWCPKWYALKSTSWEFIVMMI------ASMTAT 217

  Fly  1370 GVKECYFPIFVSRAALEREKTHIADFAPEVAWVTKSGDSELAEPIAVRPTSETVMYPAYAKWIQ 1433
            ....|.|.:                             ..||..|.|:...:|:.|......||
  Fly   218 VFFACIFVV-----------------------------CSLATIIVVQSARDTMSYKTVKYHIQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696
Rab9ENP_727438.1 Rab 8..167 CDD:206640 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.