DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab2b

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001032734.1 Gene:Rab2b / 305853 RGDID:1309117 Length:215 Species:Rattus norvegicus


Alignment Length:213 Identity:118/213 - (55%)
Similarity:148/213 - (69%) Gaps:5/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68
            ||.||||::|||..|.||||||..|.:.:|:.....|||||||:|:||:.||.:|||||||||||
  Rat     2 TYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQE 66

  Fly    69 RFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTF 133
            .|||:||||||||||||||||.|.|::||.||:||.|||..:|.|:||:|:|||.|||..|||..
  Rat    67 SFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKR 131

  Fly   134 LEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALRNL- 197
            .|...||:|:.|||:||||||..|||||::..:|.|..||:.|..|.....:||:.|.....:| 
  Rat   132 EEGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIHRKIQQGLFDVHNEANGIKIGPQQSISLV 196

  Fly   198 ---QTRQRSIN-KPDCTC 211
               .::|.|.: .||..|
  Rat   197 GPCPSQQNSSDIGPDSGC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 100/159 (63%)
Rab2bNP_001032734.1 PLN03108 1..215 CDD:178655 118/213 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.