DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RAB26

DIOPT Version :10

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:204 Identity:78/204 - (38%)
Similarity:114/204 - (55%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDS-SHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68
            ||..||.:::|.:|.||:|||..|.:..|...: ..|:|::|.:::::|.|..||||:|||||||
Human    60 YDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQE 124

  Fly    69 RFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTF 133
            ||||||.:|||.|...||:||.|::.||:.:..||.:....|..::.::|:|||.|....|.|..
Human   125 RFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKR 189

  Fly   134 LEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALRNLQ 198
            .:....|:|..|.|:|||||||.||:.||     |.:||                         :
Human   190 EDGEKLAKEYGLPFMETSAKTGLNVDLAF-----TAIAK-------------------------E 224

  Fly   199 TRQRSINKP 207
            .:|||:..|
Human   225 LKQRSMKAP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 69/160 (43%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Rab26 64..254 CDD:206695 76/200 (38%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 86..101 3/14 (21%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 119..136 14/16 (88%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.