DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and ypt4

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_594796.1 Gene:ypt4 / 2542113 PomBaseID:SPAC1B3.11c Length:234 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:102/198 - (51%)
Similarity:140/198 - (70%) Gaps:5/198 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVG----GKSVKLQIWD 63
            |:||||.|.::.|.:|:||||||..|:::::.|..|||:|::|.|||::||    .|.:||||||
pombe     4 ESYDYLVKIVLAGPSGTGKSCLLQRFVKNQWDDQVSHTVGIDFASRIISVGMGNQQKRIKLQIWD 68

  Fly    64 TAGQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEA 128
            |||||:||||.|:||||||||:||||.|::|||..|::||:|.|.:|...|.::|.|:|.||:..
pombe    69 TAGQEKFRSVARNYYRGAAGAVLVYDVTNKDSFEELSSWLSDIRAMAPSTICVVLAGSKSDLQNQ 133

  Fly   129 RDVTFLEASTFAQENELIFL-ETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGA 192
            |.|:..||:.|..|..:... |||:.||.||||.||....||:.:||.||:||:....|||||..
pombe   134 RQVSTEEAAEFCSEKHISSAHETSSYTGSNVEECFLSVVSTIITRIELGEIDPQDQSLGIQYGDL 198

  Fly   193 ALR 195
            :.|
pombe   199 SFR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 83/164 (51%)
ypt4NP_594796.1 RAB 10..178 CDD:197555 85/167 (51%)
Rab 10..173 CDD:206640 83/162 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 174 1.000 Domainoid score I866
eggNOG 1 0.900 - - E2759_KOG0086
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I957
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - otm47404
orthoMCL 1 0.900 - - OOG6_102241
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1999
SonicParanoid 1 1.000 - - X808
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.