DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and Rab11b

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_030105459.1 Gene:Rab11b / 19326 MGIID:99425 Length:278 Species:Mus musculus


Alignment Length:162 Identity:84/162 - (51%)
Similarity:107/162 - (66%) Gaps:4/162 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRSVTRS 76
            ::||.:|.|||.||..|..::|..:|..||||||.:|.:.|.||::|.||||||||||:|::|.:
Mouse    75 VLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSA 139

  Fly    77 YYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLEASTFAQ 141
            |||||.|||||||.....::..:..||.:.|..|..||||:|||||.||...|.|...||..||:
Mouse   140 YYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAE 204

  Fly   142 ENELIFLETSAKTGENVEEAFLKCSKTILAKI 173
            :|.|.|:||||....||||||    |.||.:|
Mouse   205 KNNLSFIETSALDSTNVEEAF----KNILTEI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 81/156 (52%)
Rab11bXP_030105459.1 Rab11_like 74..233 CDD:206660 84/162 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.