DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and rab-14

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_510572.1 Gene:rab-14 / 181649 WormBaseID:WBGene00004276 Length:210 Species:Caenorhabditis elegans


Alignment Length:207 Identity:119/207 - (57%)
Similarity:147/207 - (71%) Gaps:4/207 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQER 69
            |.|:||::|||..|.|||||||.|.|.||..|..||||||||:||:.|.|:.:||||||||||||
 Worm     8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQER 72

  Fly    70 FRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFL 134
            ||:|||||||||||||:|||.|.|.::|.|::||.||::|.:||..|.|:|||.|||:.|||.:.
 Worm    73 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYE 137

  Fly   135 EASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGAALRNLQT 199
            ||..||:||.|.|||.|||||.|||:|||:.:|.|...|:.|.||.....:|:|    ..:||..
 Worm   138 EAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQNIQDGSLDLNAADTGVQ----PKQNLPR 198

  Fly   200 RQRSINKPDCTC 211
            ...:..|.||.|
 Worm   199 AAENNGKKDCNC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 104/159 (65%)
rab-14NP_510572.1 Rab14 10..175 CDD:133322 106/164 (65%)
RAB 12..175 CDD:197555 105/162 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.