DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-6.4 and Uqcr11

DIOPT Version :9

Sequence 1:NP_001261057.1 Gene:UQCR-6.4 / 36991 FlyBaseID:FBgn0034245 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_001119569.1 Gene:Uqcr11 / 690848 RGDID:1590985 Length:56 Species:Rattus norvegicus


Alignment Length:50 Identity:15/50 - (30%)
Similarity:31/50 - (62%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFEKSE 57
            |.::.|:|.::|.:...:|....:.:::.|||:|:|.:||....||:|.:
  Rat     7 GPRYRELAKNWIPTAGMWGTVGAVGLVWVTDWRLILDWVPYINGKFKKDD 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-6.4NP_001261057.1 UCR_6-4kD 7..53 CDD:401083 12/44 (27%)
Uqcr11NP_001119569.1 UCR_6-4kD 2..52 CDD:401083 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E27Q
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110599
Panther 1 1.100 - - LDO PTHR15420
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.