DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-6.4 and ucr-11

DIOPT Version :9

Sequence 1:NP_001261057.1 Gene:UQCR-6.4 / 36991 FlyBaseID:FBgn0034245 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_001379967.1 Gene:ucr-11 / 266653 WormBaseID:WBGene00019007 Length:56 Species:Caenorhabditis elegans


Alignment Length:44 Identity:14/44 - (31%)
Similarity:28/44 - (63%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKF 53
            |:|....::.:|...:||:|.|..:|:.:||.|.||:|::..::
 Worm    11 KNAFTNPNYFKSYGAYGGSAFLLAIYFCEWKTVGQYIPLWNKRY 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-6.4NP_001261057.1 UCR_6-4kD 7..53 CDD:401083 14/42 (33%)
ucr-11NP_001379967.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110599
Panther 1 1.100 - - LDO PTHR15420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.