powered by:
Protein Alignment UQCR-6.4 and ucr-11
DIOPT Version :9
Sequence 1: | NP_001261057.1 |
Gene: | UQCR-6.4 / 36991 |
FlyBaseID: | FBgn0034245 |
Length: | 57 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379967.1 |
Gene: | ucr-11 / 266653 |
WormBaseID: | WBGene00019007 |
Length: | 56 |
Species: | Caenorhabditis elegans |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 28/44 - (63%) |
Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKF 53
|:|....::.:|...:||:|.|..:|:.:||.|.||:|::..::
Worm 11 KNAFTNPNYFKSYGAYGGSAFLLAIYFCEWKTVGQYIPLWNKRY 54
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
UQCR-6.4 | NP_001261057.1 |
UCR_6-4kD |
7..53 |
CDD:401083 |
14/42 (33%) |
ucr-11 | NP_001379967.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007578 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_110599 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15420 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.