DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-6.4 and UQCR11

DIOPT Version :9

Sequence 1:NP_001261057.1 Gene:UQCR-6.4 / 36991 FlyBaseID:FBgn0034245 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_006821.1 Gene:UQCR11 / 10975 HGNCID:30862 Length:56 Species:Homo sapiens


Alignment Length:48 Identity:13/48 - (27%)
Similarity:29/48 - (60%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFEK 55
            |.::.|:..:::.:...:|....:.:::.|||:|:|.:||....||:|
Human     7 GPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKK 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-6.4NP_001261057.1 UCR_6-4kD 7..53 CDD:401083 10/44 (23%)
UQCR11NP_006821.1 UCR_6-4kD 1..55 CDD:312522 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E27Q
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110599
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.