Sequence 1: | NP_001261057.1 | Gene: | UQCR-6.4 / 36991 | FlyBaseID: | FBgn0034245 | Length: | 57 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006821.1 | Gene: | UQCR11 / 10975 | HGNCID: | 30862 | Length: | 56 | Species: | Homo sapiens |
Alignment Length: | 48 | Identity: | 13/48 - (27%) |
---|---|---|---|
Similarity: | 29/48 - (60%) | Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFEK 55 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
UQCR-6.4 | NP_001261057.1 | UCR_6-4kD | 7..53 | CDD:401083 | 10/44 (23%) |
UQCR11 | NP_006821.1 | UCR_6-4kD | 1..55 | CDD:312522 | 13/48 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2E27Q | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007578 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_110599 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.670 |