powered by:
Protein Alignment UQCR-6.4 and uqcr11
DIOPT Version :9
Sequence 1: | NP_001261057.1 |
Gene: | UQCR-6.4 / 36991 |
FlyBaseID: | FBgn0034245 |
Length: | 57 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004911087.1 |
Gene: | uqcr11 / 100380065 |
XenbaseID: | XB-GENE-992168 |
Length: | 56 |
Species: | Xenopus tropicalis |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 27/47 - (57%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFE 54
|.::.::|.::....|.:|....:.:::.|||:|.|.|||....||:
Frog 7 GPRYQQLAKNWAPVLATWGSVGAVGLIWATDWRLFLDYVPYVNGKFK 53
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007578 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.