DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-6.4 and si:ch1073-325m22.2

DIOPT Version :10

Sequence 1:NP_611233.1 Gene:UQCR-6.4 / 36991 FlyBaseID:FBgn0034245 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_001177735.3 Gene:si:ch1073-325m22.2 / 100333135 ZFINID:ZDB-GENE-030131-6614 Length:56 Species:Danio rerio


Alignment Length:50 Identity:21/50 - (42%)
Similarity:34/50 - (68%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFEKSE 57
            |.|:|.||.:::.:...:|||.|:..:::|||:|:|.|||....||:|.|
Zfish     7 GNKYASIAKTWVPNLVFWGGAGGVVFVHFTDWRLILDYVPYINGKFKKDE 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-6.4NP_611233.1 UCR_6-4kD 7..53 CDD:462652 17/44 (39%)
si:ch1073-325m22.2NP_001177735.3 None

Return to query results.
Submit another query.