powered by:
Protein Alignment POSH and YSC84
DIOPT Version :9
Sequence 1: | NP_523776.1 |
Gene: | POSH / 36990 |
FlyBaseID: | FBgn0040294 |
Length: | 838 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011880.1 |
Gene: | YSC84 / 856409 |
SGDID: | S000001058 |
Length: | 468 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 57 |
Identity: | 30/57 - (52%) |
Similarity: | 40/57 - (70%) |
Gaps: | 2/57 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 PHAYALFDFASGEATDLKFKKGDLILIKHRID--NNWFVGQANGQEGTFPINYVKVS 192
|.|.||::||..:..||.|||||:|.|..:.| |:|:.|:.||:||.||.|||:||
Yeast 412 PTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRVS 468
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm46655 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.