DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and BEM1

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_009759.3 Gene:BEM1 / 852499 SGDID:S000000404 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:373 Identity:74/373 - (19%)
Similarity:112/373 - (30%) Gaps:151/373 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 HAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQ---EGTFPINYVKV--------- 191
            :|..|:||.:.:|.:|....|:.:.|....:..||:.:..|:   .|..|:.:|.:         
Yeast   159 YAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYAT 223

  Fly   192 ---------SVPLPMPQ----CIAMYDF------------------------------------- 206
                     ||.||..|    .||.|..                                     
Yeast   224 GNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVEQQQQQSITKPQNKSAKLVDGELLVKASV 288

  Fly   207 -KMGPNDEE----GCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFVELNAAAKKLLDSGL 266
             ..|..||:    .|.|.......| ::|...::.:.:: |.:..||       |.|.||.|:| 
Yeast   289 ESFGLEDEKYWFLVCCELSNGKTRQ-LKRYYQDFYDLQV-QLLDAFP-------AEAGKLRDAG- 343

  Fly   267 HTHPFCHPPKQQGQRALPPVPVIDPTVVTESSSGSSNSTPGSSNSSSTSSSNNCSPNHQISLPNT 331
                     .|..:|.:|.:|               ...|..:||.:.....:.: .:...|.|.
Yeast   344 ---------GQWSKRIMPYIP---------------GPVPYVTNSITKKRKEDLN-IYVADLVNL 383

  Fly   332 PQHVVASGSASVRFRDKGAKEKRHSLNALLGGGAP------------------------------ 366
            |.::..|             |..|||..:|..|..                              
Yeast   384 PDYISRS-------------EMVHSLFVVLNNGFDREFERDENQNNIKTLQENDTATFATASQTS 435

  Fly   367 --LSLLQTNRHSAEILSLPHELSRLEVSSSTALKPTSAPQTSRVLKTT 412
              .|..|.|..:.|.|.|..:||.|.:|.|   |...|..||. ||||
Yeast   436 NFASTNQDNTLTGEDLKLNKKLSDLSLSGS---KQAPAQSTSG-LKTT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595 14/54 (26%)
SH3_SH3RF_2 199..251 CDD:212721 14/97 (14%)
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719
BEM1NP_009759.3 SH3_Bem1p_1 76..127 CDD:212811
SH3_Bem1p_2 159..214 CDD:212812 14/54 (26%)
PX_Bem1p 284..400 CDD:132800 31/163 (19%)
PB1 478..549 CDD:214770 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46655
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.