DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment POSH and RVS167

DIOPT Version :9

Sequence 1:	NP_523776.1	Gene:	POSH / 36990	FlyBaseID:	FBgn0040294	Length:	838	Species:	Drosophila melanogaster
Sequence 2:	NP_010676.1	Gene:	RVS167 / 851996	SGDID:	S000002796	Length:	482	Species:	Saccharomyces cerevisiae

Alignment Length:	143	Identity:	43/143 - (30%)
Similarity:	55/143 - (38%)	Gaps:	46/143 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    80 AAAG--KGEEKGEETETQPERAKPQPPAESVAPPDNQLLQLQSHQQSHQPARHKQRRFLLPHAY- 141
            ||.|  .|...|....|.|:.|..|      :||...|...||.||...|          |.||
Yeast   354 AAVGTAAGAAAGAVPGTYPQYAAAQ------SPPLTGLGFQQSPQQQQGP----------PPAYS 402

  Fly   142 -------------------------ALFDFASGEATDLKFKKGDLILIKHRID--NNWFVGQANG 179
                                     ||:|:.:..|.||.|..|.:|.|..|..  |.|:.|:.||
Yeast   403 NPLTSPVAGTPAAAVAAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNG 467

  Fly   180 QEGTFPINYVKVS 192
            |:|.||.|||:::
Yeast   468 QQGVFPGNYVQLN 480

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
POSH	NP_523776.1	RING	11..53	CDD:238093
		SH3	139..191	CDD:302595	25/79 (32%)
		SH3_SH3RF_2	199..251	CDD:212721
		SH3_SH3RF_3	424..477	CDD:212717
		SH3_SH3RF_C	782..836	CDD:212719
RVS167	NP_010676.1	BAR_Rvs167p	29..245	CDD:153283
RVS167	NP_010676.1	SH3	425..478	CDD:418401	22/52 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm46655
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000