DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and NBP2

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_010446.3 Gene:NBP2 / 851740 SGDID:S000002569 Length:236 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:26/92 - (28%)
Similarity:42/92 - (45%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 DASHVLSPSSNMITEAAIKASATTKSPYCTRESRFRCIVPYPPNSDIELELHLGDIIYVQRKQKN 813
            :...::|.|||.......:.|.|....|...: |...:..:.|.:|.||.|..|||:::..|...
Yeast    82 EEDEMVSDSSNGEDTYNKRQSITLPDDYIVNQ-RAVALYDFEPENDNELRLAEGDIVFISYKHGQ 145

  Fly   814 GWYKGTHARTHKTGLFP---ASFVEPD 837
            ||....:....||||.|   .|:::|:
Yeast   146 GWLVAENESGSKTGLVPEEFVSYIQPE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719 18/56 (32%)
NBP2NP_010446.3 SH3_Nbp2-like 114..168 CDD:212799 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3230
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4993
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.