DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and NBP2

DIOPT Version :10

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_010446.3 Gene:NBP2 / 851740 SGDID:S000002569 Length:236 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:26/92 - (28%)
Similarity:42/92 - (45%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 DASHVLSPSSNMITEAAIKASATTKSPYCTRESRFRCIVPYPPNSDIELELHLGDIIYVQRKQKN 813
            :...::|.|||.......:.|.|....|...: |...:..:.|.:|.||.|..|||:::..|...
Yeast    82 EEDEMVSDSSNGEDTYNKRQSITLPDDYIVNQ-RAVALYDFEPENDNELRLAEGDIVFISYKHGQ 145

  Fly   814 GWYKGTHARTHKTGLFP---ASFVEPD 837
            ||....:....||||.|   .|:::|:
Yeast   146 GWLVAENESGSKTGLVPEEFVSYIQPE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RAD18 6..>113 CDD:227719
RING-HC_SH3RF3 8..53 CDD:438408
SH3 139..191 CDD:473055
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719 18/56 (32%)
NBP2NP_010446.3 SH3_Nbp2-like 114..168 CDD:212799 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.