DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and AT1G31440

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_174429.1 Gene:AT1G31440 / 840034 AraportID:AT1G31440 Length:439 Species:Arabidopsis thaliana


Alignment Length:394 Identity:70/394 - (17%)
Similarity:129/394 - (32%) Gaps:120/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 ITGVFPGNYLTPLRA-------RDQQQLMHQWKYVPQNADAQMAQVQQHPVAPDVRLNNMLSMQP 523
            :.||.......|:|.       .|.:.|::.:..:.|..:||         |.|| |.....::.
plant   124 LLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQEVEAQ---------ATDV-LRRRSKLKE 178

  Fly   524 PDLPPRQQQATATTTSCSVWSKPVEALFSRKSEPKPETATASTTSSSSSGAVGLMRRLTHMKTRS 588
            .|:   .::|.....:..  |:..|...|.|:..|..|..................|......||
plant   179 SDI---SEEAYIKLKNSE--SRLAELKSSMKTLGKEATKAMLEVDDQQQNVTSQRLRALVEAERS 238

  Fly   589 KSPGA--SLQQVPKEAISTNVEFTTNPSAKLHPVHVR-SGSCPSQLQHSQPLNE---TPAAKTAA 647
            ....|  .|.::..|.|:......::|  |..|:|:. |.|.|.|..:|....|   .|..|..|
plant   239 YHRNALDILDKLHSEMIAEEEAIGSSP--KSLPLHIEDSASLPQQEPNSNSSGEIKSNPLGKIKA 301

  Fly   648 QQQQFL---PKQL--PSASTNSVSYGSQRVKGSKERPHLICARQSLDAATFRSMYNNAASPPPPT 707
            .:::.:   |:::  ||......|...:..|.:.::                             
plant   302 SRREEIKSNPQEVTKPSPKDEMKSSPQEETKSNHQK----------------------------- 337

  Fly   708 TSVAPAVYAGGQQQVIPGGGAQSQLHANMIIAPSHRKSHSLDASHVLSPSSNMITEAAIKASATT 772
                 .:.:..|:::                    :||:..|..|    :..::::         
plant   338 -----EIKSSPQEEI--------------------KKSNGSDDHH----NHQLLSQ--------- 364

  Fly   773 KSPYCTRESRF--RCIVPYPPNSDIELELHLGDIIYVQRKQKNGW----YKGTHARTHKTGLFPA 831
                  .:|.|  :.:.|:...:..||.|.:.|.:.|::....||    |||      |.|.||:
plant   365 ------NDSYFLAKVVHPFDAQAPGELSLAVDDYVIVRQVAGTGWSEGEYKG------KAGWFPS 417

  Fly   832 SFVE 835
            ::||
plant   418 AYVE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717 2/10 (20%)
SH3_SH3RF_C 782..836 CDD:212719 18/60 (30%)
AT1G31440NP_174429.1 BAR_SH3P_plant 45..253 CDD:153291 26/143 (18%)
SH3 370..422 CDD:302595 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.