DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and AT4G34660

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_567969.1 Gene:AT4G34660 / 829618 AraportID:AT4G34660 Length:368 Species:Arabidopsis thaliana


Alignment Length:299 Identity:66/299 - (22%)
Similarity:112/299 - (37%) Gaps:80/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 VEALFSRKSEPKPETATASTTSSSSSGAVGLMRRLTHMKTRSKSPGASLQQVPKEAISTNVEFTT 611
            ::||.::.:||    ..|....:....|..|.:|...|:..:::....:.:...:|    .|...
plant   126 LKALGTQVAEP----LRAMVLGAPLEDARHLAQRYDRMRQEAEAQATEVARRQAKA----RESQG 182

  Fly   612 NPSAKLHPVHVRSGSCPSQLQHSQPLNETPAAKTAA--------QQQQFLPKQLPSASTNSVSYG 668
            ||.     :.::..|..::| |....|.|...|.||        |||:...::|.|...:..:| 
plant   183 NPD-----ILMKLESAEAKL-HDLKSNMTILGKEAASALASVEDQQQKLTLERLLSMVESERAY- 240

  Fly   669 SQRVKGSKER--PHLICARQSLDAATFRSMYNNAASPPPPTTSVAPAVYAGGQQQVIPGGGAQSQ 731
            .|||....::  ..::..||.::|.:..|..:  :.||||:...|..|:|             ||
plant   241 HQRVLQILDQLEGEMVSERQRIEAPSTPSSAD--SMPPPPSYEEANGVFA-------------SQ 290

  Fly   732 LHANMIIAPSHRKSHSLDASHVLSPSSNMITEAAIKASATTKSPYCTRESRFRCIVPYPPNSDIE 796
            :|               |.|                   |....|...|..|    ||...:|:|
plant   291 MH---------------DTS-------------------TDSMGYFLGEVLF----PYHGVTDVE 317

  Fly   797 LELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVE 835
            |.|..|:.:.|::...:||.:|  ....|.|.||..::|
plant   318 LSLSTGEYVVVRKVTGSGWAEG--ECKGKAGWFPYGYIE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719 17/54 (31%)
AT4G34660NP_567969.1 BAR_SH3P_plant 45..254 CDD:153291 30/142 (21%)
SH3 303..354 CDD:418401 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.