DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and AT4G18060

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_193540.3 Gene:AT4G18060 / 827531 AraportID:AT4G18060 Length:351 Species:Arabidopsis thaliana


Alignment Length:312 Identity:72/312 - (23%)
Similarity:114/312 - (36%) Gaps:104/312 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 SLQQVPKEAISTNVEFTTNPSAKLHPVHVRSGS------CPSQLQHSQPLNETPAAKTAAQQQQF 652
            |.::..::.:.....|||     :...|:.:|:      |....::||.::|...||.||     
plant    59 SAKEFQRDIVKAAEAFTT-----IGLRHIEAGTKLSEDCCRYGNENSQNIDENILAKAAA----- 113

  Fly   653 LPKQLPSASTNSVSYGSQRVKGSKERP--HLICARQSLDAATFRSMYNNAASPPPPTTSVAPAVY 715
                         .||..|....||:.  :.:.|.|.||  ..|:|.  |.||......:|.. |
plant   114 -------------IYGDARKHVDKEQEDFNKLLASQVLD--PLRAMV--AGSPLEDARHLAQR-Y 160

  Fly   716 AGGQQQV------------------IPGGGAQSQ--------LHANMII-------------APS 741
            :..:|:.                  ||...|:.|        |.|||.:             :..
plant   161 SRMRQEAETHATEVSRRQARVREAPIPENVAKLQLAEAKMQELKANMAVLGKEATAALAAVESQQ 225

  Fly   742 HR-------------KSHSLDASHVLSP-SSNMITEAAIKASA---------TTKSPYCTRESRF 783
            ||             |::.|..:.:||. .:.|:||...|.||         :.|:.|...|   
plant   226 HRLTFQRLVAMVEGEKNYHLRIAAILSDIEAEMVTEKQHKESAPPAIPTENGSEKTSYFLAE--- 287

  Fly   784 RCIVPYPPNSDIELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVE 835
             .|.|:...|:.||:|..||.|.|::..:.||.:|  ....|.|.||.:::|
plant   288 -VIHPFSAASEKELDLDKGDYIVVRKVSQTGWAEG--ECKGKAGWFPMAYIE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719 18/54 (33%)
AT4G18060NP_193540.3 BAR 49..257 CDD:416402 45/225 (20%)
SH3 285..337 CDD:418401 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.