DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and sh3d19

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:XP_009289295.1 Gene:sh3d19 / 553811 ZFINID:ZDB-GENE-050522-481 Length:963 Species:Danio rerio


Alignment Length:326 Identity:80/326 - (24%)
Similarity:118/326 - (36%) Gaps:122/326 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ECSVCLERLDTTSKVLPCQHTFCRKCLQDIVASQHKLRCPECRILVSCKIDELPPNVLLMRILEG 75
            |..|.||.||  |:...||....:..:|   .|..|:..|    |.....:.||......|   |
Zfish   668 EVLVLLEELD--SRTFECQAGNTKGTVQ---KSHMKIITP----LTDLSSNSLPQKTSSFR---G 720

  Fly    76 MKQNAAAGKGEEKGEETETQPERAKPQPPAESVAPPDNQLLQLQSHQQSHQPARHKQRRFLLPHA 140
            |..||.:                                 ||::                     
Zfish   721 MGGNAGS---------------------------------LQVE--------------------- 731

  Fly   141 YALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKV-------------- 191
             ||:||......:|..|.||::....::|::|::|......|.||||||||              
Zfish   732 -ALYDFTPAGPGELALKAGDVVSNVEQLDDDWYMGTCRNATGFFPINYVKVLSKPNIYAPAFRNE 795

  Fly   192 --SVPLPM----PQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIA 250
              :.|.|.    |:|:|.:||:....||   |.|.:..|||:...:...||.|.:...:||||:.
Zfish   796 WKNKPSPETVRGPRCVARFDFEGEQGDE---LSFFEDDVIQLKEYLGEEWARGEVNGHVGIFPLN 857

  Fly   251 FVELNAAAKKLLDSGLHTHPFCHPPKQQGQRALPPVPVIDPTVVTESSSGSSNSTPGSSNSSSTS 315
            |||:      :.|                   ||.|||       :.|:.:..:.||.::||:.|
Zfish   858 FVEV------IED-------------------LPSVPV-------QKSAPNKIALPGMASSSTQS 890

  Fly   316 S 316
            |
Zfish   891 S 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093 13/41 (32%)
SH3 139..191 CDD:302595 18/51 (35%)
SH3_SH3RF_2 199..251 CDD:212721 18/51 (35%)
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719
sh3d19XP_009289295.1 SH3 647..696 CDD:302595 10/32 (31%)
SH3 732..782 CDD:302595 19/49 (39%)
SH3_Eve1_3 809..859 CDD:212750 18/52 (35%)
SH3_Eve1_4 904..953 CDD:212751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.