DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and l(3)05822

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_001262702.1 Gene:l(3)05822 / 47260 FlyBaseID:FBgn0010877 Length:600 Species:Drosophila melanogaster


Alignment Length:201 Identity:55/201 - (27%)
Similarity:84/201 - (41%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GEETETQPERAK----PQPPAES-------VAPPDNQLLQLQSHQQSHQPARHKQRRFLLPHAYA 142
            |.||...|...|    |.|||.|       |.......|.|.:..|.:....      ::|:|.|
  Fly   400 GSETPPSPPMPKGPPPPPPPASSGGISLLDVINGKVDALALSNGCQGYMEEE------VVPYAVA 458

  Fly   143 LFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQA-NGQEGTFPINYVKVSVPL----------- 195
            |:||...|..||.|::|:.|.:.......|..|:. :|.||.||||||.:.|||           
  Fly   459 LYDFDGIEPGDLSFREGEKIYLLDHPTPEWLRGRTRSGCEGIFPINYVDIKVPLGATGGAAAAPT 523

  Fly   196 -------------PMPQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIF 247
                         .:|..:.:|.|   |.:.||.|..:::.::.|:.|::.:|..|.:....|.|
  Fly   524 ASAAAPSPSPSQQQLPTALCLYHF---PGEVEGDLALQENELVTVLYRINEDWLYGEVAGRQGQF 585

  Fly   248 PIAFVE 253
            |..|::
  Fly   586 PANFLD 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595 22/52 (42%)
SH3_SH3RF_2 199..251 CDD:212721 13/51 (25%)
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719
l(3)05822NP_001262702.1 SH3 452..506 CDD:214620 21/53 (40%)
SH3 540..591 CDD:302595 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D77892at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46655
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.