DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POSH and gei-18

DIOPT Version :9

Sequence 1:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster
Sequence 2:NP_502681.3 Gene:gei-18 / 178357 WormBaseID:WBGene00001575 Length:304 Species:Caenorhabditis elegans


Alignment Length:164 Identity:32/164 - (19%)
Similarity:56/164 - (34%) Gaps:55/164 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 LRARDQQQLMHQWKYVP---------------------QNADA-------------QMAQVQQHP 508
            ||...:|..:|..::.|                     ||:.:             |:.:.:.|.
 Worm   142 LRLIGEQMFLHPDEHAPLVIVIAGLKANEFSEKLNKAIQNSKSETNSNNLPIEIGNQLERGELHA 206

  Fly   509 VAPDVRLNNMLSMQPPDLPPRQQQATATTTSCSVWSK--PVEALFSRKSEPKPET------ATAS 565
            :     |||.|:.|   :.||  .|..|......|..  .:.|.....:.|.|:|      :|..
 Worm   207 I-----LNNALASQ---MTPR--TAVLTNIDLLAWDAVLVLHAFADHGTFPIPKTVLLLAVSTEE 261

  Fly   566 TTSSSSSGAVGLMRRLTHMKTRSKSPGASLQQVP 599
            ||.|.:|....:::.:|:   |....|.:...:|
 Worm   262 TTYSGNSCDGKILKLVTN---RWIENGGNYDNIP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POSHNP_523776.1 RING 11..53 CDD:238093
SH3 139..191 CDD:302595
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719
gei-18NP_502681.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.