powered by:
Protein Alignment MESR4 and ING5
DIOPT Version :9
Sequence 1: | NP_001097359.1 |
Gene: | MESR4 / 36986 |
FlyBaseID: | FBgn0034240 |
Length: | 2171 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016860586.1 |
Gene: | ING5 / 84289 |
HGNCID: | 19421 |
Length: | 300 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 29/66 - (43%) |
Similarity: | 34/66 - (51%) |
Gaps: | 15/66 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 2093 PIRPPAGARLAREGESVYCYCRCPYDEVS--EMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAE 2155
|:.| .|..||.|. :|| |||.||..:|.||||||.||.:...|:|||||..
Human 240 PVDP---------NEPTYCLCH----QVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPR 291
Fly 2156 C 2156
|
Human 292 C 292
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5034 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S1994 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1434088at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.860 |
|
Return to query results.
Submit another query.