DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and ING2

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_974025.1 Gene:ING2 / 841881 AraportID:AT1G54390 Length:328 Species:Arabidopsis thaliana


Alignment Length:131 Identity:33/131 - (25%)
Similarity:46/131 - (35%) Gaps:33/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2041 PPVLPTPLPVALPVPPPPPPAATAFNQPIPP---------------ALLPNPGFATLQYFKANNI 2090
            ||..|:.|| .||:.|......:.:..|.|.               .|:|.||..........  
plant   136 PPDEPSVLP-PLPIVPKAEKRKSFYGTPQPKKIDYRDRDWDRDRDFELMPPPGSNRKDLMPIE-- 197

  Fly  2091 RYPIRPPAGARLAREGESVYCYCRCPYDEVS--EMIACDGDNCLIEWFHFECVGIMVAPQGKWFC 2153
            ..||.|         .|..||.|.    :||  :|||||.:|..:...|.....:|.:...:.||
plant   198 EQPIDP---------NEPTYCVCH----QVSFGDMIACDNENVSLLSQHLIIYFLMYSCYDETFC 249

  Fly  2154 A 2154
            :
plant   250 S 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 15/47 (32%)
ING2NP_974025.1 ING 9..122 CDD:289749
PHD_SF 208..>226 CDD:304600 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.