powered by:
Protein Alignment MESR4 and Ing2
DIOPT Version :9
Sequence 1: | NP_001097359.1 |
Gene: | MESR4 / 36986 |
FlyBaseID: | FBgn0034240 |
Length: | 2171 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_075992.2 |
Gene: | Ing2 / 69260 |
MGIID: | 1916510 |
Length: | 281 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 30/74 - (40%) |
Similarity: | 41/74 - (55%) |
Gaps: | 15/74 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 2086 KANNIRYPIRPPAGARLAREGESVYCYCRCPYDEVS--EMIACDGDNCLIEWFHFECVGIMVAPQ 2148
:|:.:.:.|.| .|..||.| ::|| |||.||.:.|.||||||.||.:...|:
Mouse 200 EASPVEFAIDP---------NEPTYCLC----NQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPK 251
Fly 2149 GKWFCAECR 2157
|||:|.:||
Mouse 252 GKWYCPKCR 260
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5034 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1434088at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.