DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and Ing5

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_079730.1 Gene:Ing5 / 66262 MGIID:1922816 Length:240 Species:Mus musculus


Alignment Length:66 Identity:29/66 - (43%)
Similarity:34/66 - (51%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  2093 PIRPPAGARLAREGESVYCYCRCPYDEVS--EMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAE 2155
            |:.|         .|..||.|.    :||  |||.||..:|.||||||.||.:...|:|||||..
Mouse   180 PVDP---------NEPTYCLCH----QVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPR 231

  Fly  2156 C 2156
            |
Mouse   232 C 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 25/47 (53%)
Ing5NP_079730.1 ING 6..105 CDD:315637
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..165
PHD_ING5 187..235 CDD:277155 26/50 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1994
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.