Sequence 1: | NP_001097359.1 | Gene: | MESR4 / 36986 | FlyBaseID: | FBgn0034240 | Length: | 2171 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
Alignment Length: | 242 | Identity: | 46/242 - (19%) |
---|---|---|---|
Similarity: | 71/242 - (29%) | Gaps: | 85/242 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 1164 QTNFYSYSEILCHICPGEVAGSVYDLQFRCCLCDMAPLPSAFRLMVHLR---KQHQACDICLEDC 1225
Fly 1226 QSQSKLSSHVWKH-------KLLHLCYRCGIAYRN-----KQDISKHLFW--------------- 1263
Fly 1264 KHG------TESAGCKQCLQKRWR------------HVYHFCVPP----------------AEFP 1294
Fly 1295 CEQCGFVFSKAIYLEVHQRMHTGDFRYACTEEGCEEKFVSRKLLLKH 1341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MESR4 | NP_001097359.1 | C2H2 Zn finger | 1272..1288 | CDD:275368 | 4/27 (15%) |
C2H2 Zn finger | 1295..1315 | CDD:275370 | 6/19 (32%) | ||
C2H2 Zn finger | 1323..1341 | CDD:275370 | 5/17 (29%) | ||
PHD_ING | 2110..2156 | CDD:276980 | |||
CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 16/50 (32%) |
C2H2 Zn finger | 191..211 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 203..229 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 219..244 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 250..266 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |