DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and ING1

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_005528.4 Gene:ING1 / 3621 HGNCID:6062 Length:422 Species:Homo sapiens


Alignment Length:297 Identity:60/297 - (20%)
Similarity:88/297 - (29%) Gaps:129/297 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly  1861 QLQSSMTRMSEGSSCSDADGQLKRSKRQRRPNKFYGYTSDDENMSAVLAPPLQVGMQLIKPQPPP 1925
            |:.|.|..:.|..: ...|..::..:.|:.    .|.|:.:...:....|..:...|..||.   
Human   233 QIVSQMVELVENRT-RQVDSHVELFEAQQE----LGDTAGNSGKAGADRPKGEAAAQADKPN--- 289

  Fly  1926 QLTWAKEDLPTPPKQRNRNNNNSSHHHHSHSNGGMAGSSRKRSKQRSLFGAGGSRPAKRHKPDPN 1990
                :|..    .:|||..|..::..:|.|.:|.......|::|.        |:..||.|    
Human   290 ----SKRS----RRQRNNENRENASSNHDHDDGASGTPKEKKAKT--------SKKKKRSK---- 334

  Fly  1991 DHLPPIPTLKIRPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPAPPPVLPTPLPVALPVP 2055
                                        :..:.||.                      |..||:.
Human   335 ----------------------------AKAEREAS----------------------PADLPID 349

  Fly  2056 PPPPPAATAFNQPIPPALLPNPGFATLQYFKANNIRYPIRPPAGARLAREGESVYCYCRCPYDEV 2120
            |         |:|                                          .||.|.....
Human   350 P---------NEP------------------------------------------TYCLCNQVSY 363

  Fly  2121 SEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAECR 2157
            .|||.||.|.|.||||||.|||:...|:|||:|.:||
Human   364 GEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCR 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 24/45 (53%)
ING1NP_005528.4 ING <189..254 CDD:289749 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..349 25/164 (15%)
PHD_ING1_2 355..399 CDD:277059 24/43 (56%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 405..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.