DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and Ing5

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster


Alignment Length:421 Identity:80/421 - (19%)
Similarity:135/421 - (32%) Gaps:179/421 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1758 EHAPMRPSNNYDIV----ENSRPSTPSLPEEASAFADK--REKVRNKKKKRERKSTCKS--GKLQ 1814
            |..|.....|:.::    :.::.:..|:...|..|..|  .....::.::|||:...|:  ||.:
  Fly    15 ESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAK 79

  Fly  1815 PVASTTPPPMDRIPGMPGMIAPLEPPTPILSHPESSLFPVTPLTHRQLQSSMTR----MSEGSSC 1875
            ..:.      |::     .:|             ...:.:.....|:|.:.:.|    :.|.:|.
  Fly    80 EYSD------DKV-----QLA-------------IQTYELVDKQIRRLDNDLARFEGEIQEKASS 120

  Fly  1876 SDADGQ---LKRSKRQRRPNKFYG-----YTSDDENMSAVLAPPLQVGMQLIKPQPPPQLTWAKE 1932
            :.|..:   .|:.:::.:.:|..|     .:||:|.                             
  Fly   121 TRAKSEEVVAKKGRKKTKDSKTTGKKKKSASSDEET----------------------------- 156

  Fly  1933 DLPTPPKQRNRNNNNSSHHHHSHSNGGMAGSSRKRSK--QRSLFGAGGSRPAKRHKPDPNDHLPP 1995
                   .|..|.:|::...:|.||.|. ||.:|:||  |......||::.              
  Fly   157 -------GRGNNQSNANSSVNSSSNAGQ-GSKKKKSKVNQEKETRKGGAQK-------------- 199

  Fly  1996 IPTLKIRPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPAPPPVLPTPLPVALPVPPPPPP 2060
             .|:::                   ||.|.|...|:..     .|..|:.      :||.|    
  Fly   200 -KTVEV-------------------DDSEKESCHTAAT-----HPSDVMD------MPVDP---- 229

  Fly  2061 AATAFNQPIPPALLPNPGFATLQYFKANNIRYPIRPPAGARLAREGESVYCYCRCPYDEVSEMIA 2125
                 |:|                                          .||.|......|||.
  Fly   230 -----NEP------------------------------------------TYCLCHQVSYGEMIG 247

  Fly  2126 CDGDNCLIEWFHFECVGIMVAPQGKWFCAEC 2156
            ||..:|.||||||.|||:...|:|||||.:|
  Fly   248 CDNPDCPIEWFHFACVGLTTKPKGKWFCPKC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 24/45 (53%)
Ing5NP_609647.1 TNG2 1..278 CDD:227367 79/419 (19%)
ING 6..108 CDD:289749 17/116 (15%)
PHD_ING4_5 234..278 CDD:277061 24/43 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1994
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.