DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and Ing3

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_573316.1 Gene:Ing3 / 32853 FlyBaseID:FBgn0030945 Length:686 Species:Drosophila melanogaster


Alignment Length:254 Identity:64/254 - (25%)
Similarity:84/254 - (33%) Gaps:69/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1944 NNNNSSHHHHSHSNGGMAGSSRKRSK-------QRSLFGAGGSRPAKRHKPDPNDHLPPIPTLKI 2001
            ::..|.|.|||.|:.|..|.......       ..|..|.||...:...:......|....|   
  Fly   449 SSTGSHHSHHSQSHHGGHGHGHGHGHGHGHGHGHHSSSGHGGGHSSHHQEKKQKKKLTTALT--- 510

  Fly  2002 RPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPAPPPVLPTPLPVALPVPPPPPPAATAFN 2066
                |||..|.:.||..:|....:.:::.||         ..|.|...:|      ...|.|.:.
  Fly   511 ----LPTVQPTAGSSSGNSIGSSSSISLESV---------NKLTTSAALA------AASATTTYM 556

  Fly  2067 QPIPPALLP----NPGFATLQYFKANNIRYPIRPPAG-------------------------ARL 2102
            .....|||.    ..|...|....|..:      |||                         ...
  Fly   557 SVGGQALLAMTPGGGGGGNLAESSAEGV------PAGMIAMNLPTTTVTPGSSLTIGENGLVVEQ 615

  Fly  2103 AREGESVY-----CYCRCPYDEVSEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAEC 2156
            ..|||..|     .||.|......:|:|||.|.|..||||:.||||...|:|||:|.:|
  Fly   616 TNEGEWSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKC 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 23/50 (46%)
Ing3NP_573316.1 ING 3..103 CDD:289749
PHD_ING3 630..674 CDD:277060 22/43 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.