DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and Ing1

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:XP_038950529.1 Gene:Ing1 / 306626 RGDID:1306330 Length:396 Species:Rattus norvegicus


Alignment Length:431 Identity:84/431 - (19%)
Similarity:132/431 - (30%) Gaps:177/431 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1810 SGK---LQPVASTTPPPMDRIPGMPGMIAPLEPPTPILSHPESSLFPVTPLTHRQLQSSMTRMSE 1871
            |||   .||....:|...:...|.|            ||...|.|     .|.|:.:.:......
  Rat    38 SGKRCSRQPAHLRSPRSTEHPSGAP------------LSTGHSKL-----CTGRRHKGTEGAKGA 85

  Fly  1872 GSSCSDADGQLKRSKRQRRPNKFYGYTSD--------------------DENMSAVL-------A 1909
            |:..::..|....|.|:.||::...:.|.                    :|:.|.||       .
  Rat    86 GAGSAEDAGSGGLSARRWRPSRAGPHPSPGSCACAPTSASLGPARSALLEEDSSLVLGVRGALPV 150

  Fly  1910 PP----LQVGMQLIKPQPPPQLTWAKEDLPTPPKQR----------------------------- 1941
            ||    :|:|.:.|..:........|.:..:..|:|                             
  Rat   151 PPHLLLVQIGRREILKELDDYYEKFKRETDSTQKRRVLHCIQRALIRSQELGDEKIQIVSQMVEL 215

  Fly  1942 --NRNNNNSSH-----HHHSHSN----GGMAGSSRKRSKQRSLFGAGGSRPAKRHKPDPNDHLPP 1995
              ||:....||     .|...|:    ||.||..:.:|:..:......::.::|.:.:.|     
  Rat   216 VENRSRQVDSHVELFEAHQDISDGTGGGGKAGQDKSKSEAITQADKPNNKRSRRQRNNEN----- 275

  Fly  1996 IPTLKIRPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPA---------PPPVLPTPLPVA 2051
                                .|::|::.:.: ::||..|..:.|         .........|..
  Rat   276 --------------------RENASNNHDHD-DITSGTPKEKKAKTSKKKKRSKAKAEREASPAD 319

  Fly  2052 LPVPPPPPPAATAFNQPIPPALLPNPGFATLQYFKANNIRYPIRPPAGARLAREGESVYCYCRCP 2116
            ||:.|         |:|                                          .||.|.
  Rat   320 LPIDP---------NEP------------------------------------------TYCLCN 333

  Fly  2117 YDEVSEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAECR 2157
            .....|||.||.|.|.||||||.|||:...|:|||:|.:||
  Rat   334 QVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 24/45 (53%)
Ing1XP_038950529.1 ING <162..224 CDD:355795 6/61 (10%)
PHD_ING1_2 329..373 CDD:277059 24/43 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.