DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and Ing2

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:XP_006253193.1 Gene:Ing2 / 290744 RGDID:1307347 Length:316 Species:Rattus norvegicus


Alignment Length:74 Identity:30/74 - (40%)
Similarity:41/74 - (55%) Gaps:15/74 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  2086 KANNIRYPIRPPAGARLAREGESVYCYCRCPYDEVS--EMIACDGDNCLIEWFHFECVGIMVAPQ 2148
            :|:.:.:.|.|         .|..||.|    ::||  |||.||.:.|.||||||.||.:...|:
  Rat   235 EASPVEFAIDP---------NEPTYCLC----NQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPK 286

  Fly  2149 GKWFCAECR 2157
            |||:|.:||
  Rat   287 GKWYCPKCR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 24/47 (51%)
Ing2XP_006253193.1 ING <93..157 CDD:289749
PHD_ING2 249..297 CDD:277153 26/51 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.