DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and sfc2

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:371 Identity:91/371 - (24%)
Similarity:129/371 - (34%) Gaps:114/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1102 NLENEYMNAASC-----CSLE--NGKYVEP----------FNERIYECFTCRFVTSTHKELYTHN 1149
            ::|.|..|..|.     |..|  ..||..|          .|||   .|.|.: |...|..|   
pombe     8 SIEIESKNLRSAKKIFHCPYEECGKKYSRPSLLEQHLRTHSNER---PFVCDY-TGCSKAFY--- 65

  Fly  1150 RRLHIKSNITCVMCQTNFYSYSEILCHICPGEVAGSVYDLQFRCCLCDMAPLPSAFRLMVHLRKQ 1214
            |:.|:|.:   ..|.||...:|   ||          ||      .||     :.|....||.:.
pombe    66 RKSHLKIH---KRCHTNVKPFS---CH----------YD------GCD-----AQFYTQQHLERH 103

  Fly  1215 ---H----------QACDICLEDCQSQSKLSSHV---WKHKLLHLC-YR-CGIAYRNKQDISKHL 1261
               |          :.||.|....|   :|.||:   ..|.|.:.| |: |.:.:..||.:..|:
pombe   104 IEVHRKPKPYACTWEGCDECFSKHQ---QLRSHISACHTHLLPYPCTYQDCELRFATKQKLQNHV 165

  Fly  1262 FWKHG---TESAGCKQCLQ----KRW----RHVYHFCVPPAEFPCEQCGFVFSKAIYLEVHQRMH 1315
            ...|.   :.|...:.|:.    ::|    .|:....||    .|..||..|..|.:|..|..:|
pombe   166 NRAHEKIISYSCPHESCVGHEGFEKWSQLQNHIREAHVP----SCSICGRQFKTAAHLRHHVVLH 226

  Fly  1316 TGDFR----YACTEEGCEEKFVSRKLLLKHASSHVAKELPQAVSVEQTADAAPTEKLEDIKEELE 1376
            .....    |.|..|||::.|.....|.||.|  |..|...|...:........:.:  ::..||
pombe   227 QTTLEERKTYHCPMEGCKKSFTRSSALKKHIS--VIHEGNMAFHCDSCGTKFGYKHM--LQRHLE 287

  Fly  1377 EGEDEK----------------EGA--HNQ-EKLLSESLTNNETPK 1403
            .|..:|                ||.  |:| ||.||.:|.::...|
pombe   288 RGTCKKAHKPYINECGIKHDGIEGVAIHDQKEKELSSNLVSDVAKK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 3/23 (13%)
C2H2 Zn finger 1295..1315 CDD:275370 7/19 (37%)
C2H2 Zn finger 1323..1341 CDD:275370 6/17 (35%)
PHD_ING 2110..2156 CDD:276980
sfc2NP_594670.1 COG5048 1..374 CDD:227381 91/371 (25%)
C2H2 Zn finger 28..47 CDD:275368 4/18 (22%)
C2H2 Zn finger 55..77 CDD:275368 7/28 (25%)
C2H2 Zn finger 85..107 CDD:275368 9/42 (21%)
C2H2 Zn finger 115..138 CDD:275368 7/25 (28%)
C2H2 Zn finger 146..165 CDD:275368 5/18 (28%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
C2H2 Zn finger 238..261 CDD:275368 10/24 (42%)
C2H2 Zn finger 269..286 CDD:275368 0/18 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.