DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and athp-3

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_503022.1 Gene:athp-3 / 178479 WormBaseID:WBGene00013799 Length:286 Species:Caenorhabditis elegans


Alignment Length:246 Identity:47/246 - (19%)
Similarity:81/246 - (32%) Gaps:81/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1460 APRSSHQEQPKLPMRSSVDDLDMPKVMLSPSSESDADELDGKSKLEDKEEKPLDGSTEEKALDAD 1524
            |..|..::|.|:|::             :|:.|:....  |:.:.:..|||........|     
 Worm    74 AQMSKQRKQKKVPVK-------------NPAGEAKRGR--GRPRKQSSEEKVQIPKVVVK----- 118

  Fly  1525 DELEPKKEEDQVDVSIWKNLLQNQAVAIP-EEQAVKDEEREDSLVNLPPAKLHVAWSDHDYCKLY 1588
              .||||.......:.|     :|.||:. ::|..:...|        |.|:             
 Worm   119 --FEPKKRGRPAGAAKW-----SQEVAVVLQKQPQRKRGR--------PLKI------------- 155

  Fly  1589 RTPAPSPV-KQKSANKSSIKTPGENASSDSDSSSSSSSSDSDSSSCSCGSNCSCSSSNSSSSSGN 1652
             .....|| .||..:|       :|:...:.....:...:..:....||            ::..
 Worm   156 -AKKIEPVFHQKKESK-------QNSEEKALIQQEAVKGEPKNRGRPCG------------AAER 200

  Fly  1653 SDDSDSSTARGSPQKRSRKKSLKVKKSSESLKIDQNGQNEQNQVEDTTAVN 1703
            |.:......:..|:||.|           .|||.:|.:.|.||.:||..|:
 Worm   201 SREVVKKLQKQPPRKRGR-----------PLKIAKNMEPEINQKKDTKQVH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980
athp-3NP_503022.1 Asp-B-Hydro_N <81..241 CDD:191249 45/239 (19%)
PHD_TCF19_like 241..284 CDD:276992 47/246 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.