DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and lsy-13

DIOPT Version :10

Sequence 1:NP_523775.2 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_001367153.1 Gene:lsy-13 / 178470 WormBaseID:WBGene00020287 Length:247 Species:Caenorhabditis elegans


Alignment Length:79 Identity:28/79 - (35%)
Similarity:40/79 - (50%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  2095 RPPAGARLAREGESVYCYCRCPYDEVSEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCA-ECRP 2158
            :.|...:.....|....||.|..|:...||.|:...|...||||.|:|::.||.|.|:|. ||| 
 Worm   160 KKPESEKAVAAAEPPKMYCWCQLDKNDTMIECENPGCKYGWFHFTCIGMITAPAGDWYCTNECR- 223

  Fly  2159 KYSEGIYQGAK-PQ 2171
              ::|:...|: ||
 Worm   224 --AQGLAAVAEAPQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_523775.2 C2H2 Zn finger 1272..1288 CDD:275368
zf-C2H2 1293..1315 CDD:395048
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 19/46 (41%)
lsy-13NP_001367153.1 PHD_SF 177..222 CDD:473978 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.