DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and ZNF784

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens


Alignment Length:219 Identity:52/219 - (23%)
Similarity:76/219 - (34%) Gaps:73/219 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1191 FRCCLCDMAPLPSAFRLMVHL---RKQHQA-------------CDICLEDCQSQSKLSSHVWKH- 1238
            |.|.||     |:||||:..|   ...|.|             |.:|...|...:.|.:|...| 
Human    65 FHCALC-----PAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHT 124

  Fly  1239 -KLLHLCYRCGIAYRNKQDISKHLFWKHGTE--------------------------------SA 1270
             :..:.|..|..|::....:.:|.. :||.|                                :|
Human   125 GERPYRCALCPRAFKALAPLLRHQH-RHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAA 188

  Fly  1271 G--------CKQCLQKRWRHVY----HFCVPPAEFP--CEQCGFVFSKAIYLEVHQRMHTGDFRY 1321
            |        |:.| .|.:|...    |..|...|.|  |..||..|:::..|..|.|:|||:..:
Human   189 GAAVGKPFACRFC-AKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPF 252

  Fly  1322 ACTEEGCEEKFVSRKLLLKHASSH 1345
            .||.  |:..|.:.....||..:|
Human   253 RCTL--CDRTFNNSSNFRKHQRTH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 5/19 (26%)
C2H2 Zn finger 1295..1315 CDD:275370 7/19 (37%)
C2H2 Zn finger 1323..1341 CDD:275370 4/17 (24%)
PHD_ING 2110..2156 CDD:276980
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368 9/24 (38%)
C2H2 Zn finger 103..123 CDD:275368 5/19 (26%)
C2H2 Zn finger 131..151 CDD:275368 4/20 (20%)
COG5048 <194..276 CDD:227381 25/84 (30%)
C2H2 Zn finger 198..218 CDD:275368 5/20 (25%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
C2H2 Zn finger 254..274 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.