DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESR4 and LOC101885450

DIOPT Version :9

Sequence 1:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster
Sequence 2:XP_005163710.1 Gene:LOC101885450 / 101885450 -ID:- Length:234 Species:Danio rerio


Alignment Length:173 Identity:47/173 - (27%)
Similarity:63/173 - (36%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1191 FRCCLCDMAPLPSAFRLMVHLRKQHQACDICLEDCQSQSKLSSHVWKHKLLH------LCYRCGI 1249
            |||..|... ...|..:..|||..........:.|..:..|:||:..|..:|      ||..||.
Zfish    67 FRCLQCGKT-FKRATDVKSHLRYHSGERPFTCDQCGKKFILASHLKTHLSVHTHEKPFLCSICGK 130

  Fly  1250 AYRNKQDISKHLFWKHGTESAGCKQC---------LQKRWRHVYHFCVPPAEFPCEQCGFVFSKA 1305
            ::........|.....|..:..|..|         |:...|  .|....|  :.|..||..||.:
Zfish   131 SFTRLFTFKDHENIHSGVRAFSCPDCGNTFITANALKMHQR--VHTGEKP--YKCSHCGRRFSHS 191

  Fly  1306 IYLEVHQRMHTGDFRYACTEEGCEEKFVSRKLLLKHASSHVAK 1348
            ..|..|:|:|||:..|.|..  |..:|.....||.||..|..|
Zfish   192 GGLRRHERIHTGERPYHCPL--CGRRFTQSSNLLTHAKRHCPK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 5/24 (21%)
C2H2 Zn finger 1295..1315 CDD:275370 8/19 (42%)
C2H2 Zn finger 1323..1341 CDD:275370 5/17 (29%)
PHD_ING 2110..2156 CDD:276980
LOC101885450XP_005163710.1 COG5048 <48..214 CDD:227381 40/153 (26%)
C2H2 Zn finger 69..89 CDD:275368 6/20 (30%)
zf-H2C2_2 81..104 CDD:290200 4/22 (18%)
C2H2 Zn finger 97..117 CDD:275368 5/19 (26%)
C2H2 Zn finger 125..145 CDD:275368 4/19 (21%)
C2H2 Zn finger 153..173 CDD:275368 4/21 (19%)
zf-H2C2_2 165..190 CDD:290200 8/28 (29%)
C2H2 Zn finger 181..201 CDD:275368 8/19 (42%)
zf-H2C2_2 194..218 CDD:290200 10/25 (40%)
C2H2 Zn finger 209..229 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.